ZP1 anticorps (N-Term)
-
- Antigène Voir toutes ZP1 Anticorps
- ZP1 (Zona Pellucida Glycoprotein 1 (ZP1))
-
Épitope
- AA 102-139, N-Term
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ZP1 est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Zona pellucida sperm-binding protein 1(ZP1) detection. Tested with WB in Human,Rat.
- Séquence
- HVLEKDGRFH LRVFMEAVLP NGRVDVAQDA TLICPKPD
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Zona pellucida sperm-binding protein 1(ZP1) detection. Tested with WB in Human,Rat.
Gene Name: zona pellucida glycoprotein 1
Protein Name: Zona pellucida sperm-binding protein 1 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the N-terminus of human ZP1 (102-139aa HVLEKDGRFHLRVFMEAVLPNGRVDVAQDATLICPKPD), different from the related mouse sequence by four amino acids, and from the related rat sequence by five amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product ZP1 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- ZP1 (Zona Pellucida Glycoprotein 1 (ZP1))
- Autre désignation
- ZP1 (ZP1 Produits)
- Synonymes
- anticorps zona pellucida glycoprotein 1 (sperm receptor), anticorps zona pellucida glycoprotein 1, anticorps ZP1, anticorps Zp1
- Sujet
-
Zona pellucida sperm-binding protein 1 (ZP1) is a protein that belopngs to the mammalian zona pellucida. The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. Zp1 ensures the structural integrity of the zona pellucida. Mutations in this gene are a cause of oocyte maturation defect and infertility. And this gene is mapped to chromosome 11q12.2.
Synonyms: Zp1 | Zp-1 | Zp 1 | P60852 - ID gène
- 22917
- UniProt
- P60852
-