Fetuin A anticorps

N° du produit ABIN4950053

Cet anticorps anti-Fetuin A est un anticorps Polyclonal produit chez le Lapin, détectant Fetuin A dans WB, ELISA, FACS et IHC (p). Convient pour Humain et Rat.

Aperçu rapide pour Fetuin A anticorps (ABIN4950053)

Antigène: Fetuin A (AHSG) (alpha-2-HS-Glycoprotein (AHSG))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Fetuin A est non-conjugé

Application: Western Blotting (WB), ELISA, Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-Fetuin A anticorps

Purification: Antigen affinity

Immunogène: Amino acids DDPETEEAALVAIDYINQNLPWGYKHTLNQIDE of human AHSG were used as the immunogen for the AHSG antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the AHSG antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,FACS: 1-3 μg/10^6 cells,ELISA: 0.1-0.5 μg/mL (human protein tested)

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the AHSG antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur Fetuin A

Antigène: Fetuin A (AHSG) (alpha-2-HS-Glycoprotein (AHSG))

Autre désignation: Fetuin-A / AHSG

Sujet: Alpha-2-HS-glycoprotein (AHSG), also known as Fetuin-A, is a protein that in humans is encoded by the AHSG gene. Fetuin-A belongs to the fetuin class of plasma binding proteins and is more abundant in fetal than adult blood. Its gene is mapped to 3q27. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue.

UniProt: P02765