BCAR3 anticorps

N° du produit ABIN4950307

Détail du produit anti-BCAR3 anticorps

Antigène: BCAR3 (Breast Cancer Anti-Estrogen Resistance 3 (BCAR3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BCAR3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: Amino acids KGAQVNQTERYEKFNQILTALSRKLEPPPVKQAEL of human BCAR3 were used as the immunogen for the BCAR3 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the BCAR3 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the BCAR3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur BCAR3

Antigène: BCAR3 (Breast Cancer Anti-Estrogen Resistance 3 (BCAR3))

Autre désignation: BCAR3 (BCAR3 Produits)

Synonymes: anticorps NSP2, anticorps SH2D3B, anticorps AI131758, anticorps AND-34, anticorps BCAR3, anticorps breast cancer anti-estrogen resistance 3, anticorps breast cancer anti-estrogen resistance 3 L homeolog, anticorps BCAR3, anticorps Bcar3, anticorps bcar3, anticorps bcar3.L

Sujet: Breast cancer anti-estrogen resistance protein 3 is a protein that in humans is encoded by the BCAR3 gene. Breast tumors are initially dependent on estrogens for growth and progression and can be inhibited by anti-estrogens such as tamoxifen. However, breast cancers progress to become anti-estrogen resistant. BCAR3 was identified in the search for genes involved in the development of estrogen resistance. The gene encodes a component of intracellular signal transduction that causes estrogen-independent proliferation in human breast cancer cells. The protein contains a putative src homology 2 (SH2) domain, a hall mark of cellular tyrosine kinase signaling molecules, and is partly homologous to the cell division cycle protein CDC48. Multiple transcript variants encoding different isoforms have been found for this gene.

UniProt: O75815