FABP1 (liver) anticorps

N° du produit ABIN4950973

L’anticorps Lapin Polyclonal anti-FABP1 (liver) a été validé pour WB et IHC (p). Il convient pour détecter FABP1 (liver) dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour FABP1 (liver) anticorps (ABIN4950973)

Antigène: FABP1 (liver) (LBFABP) (Liver Basic Fatty Acid Binding Protein (LBFABP))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FABP1 (liver) est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-FABP1 (liver) anticorps

Purification: Antigen affinity

Immunogène: Amino acids KYQLQSQENFEAFMKAIGLPEELIQKGKDIK of human FABP were used as the immunogen for the FABP antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the FABP antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the FABP antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur FABP1 (liver)

Antigène: FABP1 (liver) (LBFABP) (Liver Basic Fatty Acid Binding Protein (LBFABP))

Autre désignation: FABP1 (liver)

Sujet: Fatty acid binding protein 1, liver, also known as FABP1 or FABPL, is a human gene locating at 2p11. FABP1 encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind free fatty acids, their CoA derivatives, bilirubin, organic anions, and other small molecules. FABP1 and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metaboism. The liver form of FABP may be identical to the major liver protein-1 (Lvp-1), which is encoded by a gene situated within 1 cM of Ly-2.

UniProt: P07148