Liver Basic Fatty Acid Binding Protein (LBFABP) anticorps

Détails pour le produit réf. ABIN4950973
Antigène
Reactivité
Humain, Souris, Rat (Rattus)
1
1
Hôte
Lapin
1
Clonalité
Polyclonal
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
1
1
Options
Immunogène Amino acids KYQLQSQENFEAFMKAIGLPEELIQKGKDIK of human FABP were used as the immunogen for the FABP antibody.
Isotype IgG
Purification Antigen affinity
Antigène
Autre désignation FABP1 (liver)
Sujet Fatty acid binding protein 1, liver, also known as FABP1 or FABPL, is a human gene locating at 2p11. FABP1 encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind free fatty acids, their CoA derivatives, bilirubin, organic anions, and other small molecules. FABP1 and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metaboism. The liver form of FABP may be identical to the major liver protein-1 (Lvp-1), which is encoded by a gene situated within 1 cM of Ly-2.
UniProt P07148
Indications d'application Optimal dilution of the FABP antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the FABP antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Liver Basic Fatty Acid Binding Protein (LBFABP) antibody (ABIN4950973) IHC testing of FFPE rat intestine with FABP antibody. HIER: Boil the paraffin section...
Image no. 2 for anti-Liver Basic Fatty Acid Binding Protein (LBFABP) antibody (ABIN4950973) Western blot testing of 1) rat liver, 2) mouse liver, 3) human SMMC, 4) HepG2 and 5) ...
Image no. 3 for anti-Liver Basic Fatty Acid Binding Protein (LBFABP) antibody (ABIN4950973) IHC testing of FFPE mouse intestine with FABP antibody. HIER: Boil the paraffin secti...
Avez-vous cherché autre chose?