ELAV (Embryonic Lethal, Abnormal Vision, Drosophila)-Like (ELAVL) anticorps

N° du produit ABIN4951387

L’anticorps anti-ELAV (Embryonic Lethal, Abnormal Vision, Drosophila)-Like Polyclonal Lapin est utilisé pour la détection de ELAV (Embryonic Lethal, Abnormal Vision, Drosophila)-Like dans des échantillons de Souris, Rat et Humain. Il a été validé pour IHC (p), WB et IF.

Aperçu rapide pour ELAV (Embryonic Lethal, Abnormal Vision, Drosophila)-Like (ELAVL) anticorps (ABIN4951387)

Antigène: ELAV (Embryonic Lethal, Abnormal Vision, Drosophila)-Like (ELAVL)

Reactivité: Souris, Rat, Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB), Immunofluorescence (IF)

Détail du produit

Fonction: HuD Antibody / ELAVL4

Séquence: MEPQVSNGPT SNTSNGPSSN NRNCPSPMQT GATTDDSK

Purification: Antigen affinity

Immunogène: Amino acids MEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSK of human ELAVL4/HuD were used as the immunogen for the HuD antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the HuD antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the HuD antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détail du antigène

Antigène: ELAV (Embryonic Lethal, Abnormal Vision, Drosophila)-Like (ELAVL)

Autre désignation: HuD / ELAVL4

Sujet: HuD, otherwise known as ELAV-like protein 4 or PNEM, is a protein that in humans is encoded by the ELAVL4 gene. This human gene is located at 1p34 by in situ hybridization. The HuD/ELAVL4 protein is anRNA-binding protein. ELAVL4 has specificity for 3-prime uridylate-rich untranslated regions of growth factor mRNAs. And HuD is expressed only in neurons and it binds toAU-rich element-containing mRNAs. As a result of this interaction the, half-life of the transcript is increased. Also, HuD is important in neurons during brain development and plasticity.

UniProt: P26378