SECTM1 anticorps

N° du produit ABIN4952492

Cet anticorps anti-SECTM1 Polyclonal Lapin (ABIN4952492) détecte spécifiquement SECTM1 dans WB. L’anticorps est réactif avec des échantillons de Souris.

Aperçu rapide pour SECTM1 anticorps (ABIN4952492)

Antigène: SECTM1 (Secreted and Transmembrane 1 (SECTM1))

Reactivité: Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SECTM1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SECTM1 anticorps

Fonction: SECTM1 Antibody

Séquence: KLHGFQAEFK NFNLTVNAAD RQKTEDLPVT KVPDK

Purification: Antigen affinity

Immunogène: Amino acids KLHGFQAEFKNFNLTVNAADRQKTEDLPVTKVPDK of mouse SECTM1 were used as the immunogen for the SECTM1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the SECTM1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the SECTM1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur SECTM1

Antigène: SECTM1 (Secreted and Transmembrane 1 (SECTM1))

Autre désignation: SECTM1

Sujet: SECTM1B is also known as Sectm1 or K12. Secreted and transmembrane protein 1 is a protein that in humans is encoded by the SECTM1 gene. This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes.

UniProt: Q9JL59