Surfactant Protein A1 anticorps

N° du produit ABIN4952536

L’anticorps anti-Surfactant Protein A1 Polyclonal Lapin est utilisé pour la détection de Surfactant Protein A1 dans des échantillons de Humain, Rat et Souris. Il a été validé pour WB, IHC (p), IF et IHC (fro).

Aperçu rapide pour Surfactant Protein A1 anticorps (ABIN4952536)

Antigène: Surfactant Protein A1 (SFTPA1)

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Surfactant Protein A1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunofluorescence (IF), Immunohistochemistry (Frozen Sections) (IHC (fro))

Détail du produit anti-Surfactant Protein A1 anticorps

Fonction: SFTPA1/2 Antibody

Séquence: VNYTNWYRGE PAGRGKEQCV EMYTDGQWND RN

Purification: Antigen affinity

Immunogène: Amino acids VNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRN of human SFTPA1/2 were used as the immunogen for the SFTPA1/2 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the SFTPA1/2 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the SFTPA1/2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur Surfactant Protein A1

Antigène: Surfactant Protein A1 (SFTPA1)

Autre désignation: SFTPA1/2

Sujet: SFTPA1/2 is also known as SP-A. SFTPA1 encodes a lung surfactant protein that is a member of a subfamily of C-type lectins called collectins. The encoded protein binds specific carbohydrate moieties found on lipids and on the surface of microorganisms. This protein plays an essential role in surfactant homeostasis and in the defense against respiratory pathogens. Mutations in this gene are associated with idiopathic pulmonary fibrosis. Alternate splicing results in multiple transcript variants. SFTPA2 is one of several genes encoding pulmonary-surfactant associated proteins (SFTPA) located on chromosome 10. Mutations in this gene and a highly similar gene located nearby, which affect the highly conserved carbohydrate recognition domain, are associated with idiopathic pulmonary fibrosis. The current version of the assembly displays only a single centromeric SFTPA gene pair rather than the two gene pairs shown in the previous assembly which were thought to have resulted from a duplication.

UniProt: Q8IWL1