Annexin IV anticorps (Annexin A4) (AA 1-321)

Details for Product anti-ANXA4 Antibody No. ABIN513363
Antigène
  • ANXA4
  • Anx4
  • XAnx4
  • pig28
  • X-anx4
  • Xanx-4
  • ANXIV
  • anx4
  • ANX4
  • PIG28
  • ZAP36
  • Annexin-4
  • P32.5
  • PAP-II
  • PP4-X
  • AI265406
  • AIV
  • AW106930
  • annexin A4
  • annexin A4 L homeolog
  • ANXA4
  • anxa4
  • CC1G_00713
  • LOC100280951
  • Anxa4
  • anxa4.L
Épitope
AA 1-321
18
15
8
7
6
5
4
4
4
4
4
4
4
4
3
3
3
2
2
1
1
1
1
1
1
1
1
Reactivité
Humain
138
80
65
20
17
5
4
4
3
2
2
1
1
1
Hôte
Souris
159
33
2
Clonalité (Clone)
Monoclonal ()
Conjugué
Cet anticorp Annexin IV est non-conjugé
28
9
5
5
5
5
5
5
2
2
2
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), ELISA, Western Blotting (WB)
148
72
56
21
20
20
17
14
12
9
6
3
3
2
1
Options
Fonction Mouse monoclonal antibody raised against a full-length recombinant ANXA4.
Immunogène

immunogen: ANXA4 (AAH00182, 1 a.a. ~ 321 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: MAMATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD

Clone 1D3
Isotype IgG2a kappa
 Réactivité croisée Humain
Plasmids, Primers & others Plasmids, Primers & others Annexin IV products on genomics-online (e.g. as negative or positive controls)
Antigène
Autre désignation ANXA4 (ANXA4 Antibody Extrait)
Sujet Full Gene Name: annexin A4
Synonyms: ANX4,DKFZp686H02120,MGC75105,PIG28,ZAP36
ID gène 307
Indications d'application Optimal working dilution should be determined by the investigator.
Commentaires

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Conseil sur la manipulation Aliquot to avoid repeated freezing and thawing.
Stock -20 °C
Stockage commentaire Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Annexin A4 (ANXA4) (AA 1-321) antibody (ABIN513363) Immunoperoxidase of monoclonal antibody to ANXA4 on formalin-fixed paraffin-embedded ...
Image no. 2 for anti-Annexin A4 (ANXA4) (AA 1-321) antibody (ABIN513363) Western Blot analysis of ANXA4 expression in transfected 293T cell line by ANXA4 mono...
Image no. 3 for anti-Annexin A4 (ANXA4) (AA 1-321) antibody (ABIN513363) Western Blot detection against Immunogen (61.05 KDa) .
Produit citée dans: Al-Gubory, Arianmanesh, Garrel, Bhattacharya, Cash, Fowler: "Proteomic analysis of the sheep caruncular and intercaruncular endometrium reveals changes in functional proteins crucial for the establishment of pregnancy." dans: Reproduction (Cambridge, England), Vol. 147, Issue 5, pp. 599-614, 2014 (PubMed).

Yamashita, Nagano, Kanasaki, Maeda, Furuya, Inoue, Nabeshi, Yoshikawa, Yoshioka, Itoh, Abe, Kamada, Tsutsumi, Tsunoda: "Annexin A4 is a possible biomarker for cisplatin susceptibility of malignant mesothelioma cells." dans: Biochemical and biophysical research communications, Vol. 421, Issue 1, pp. 140-4, 2012 (PubMed).

Avez-vous cherché autre chose?