Tumor Protein, Translationally-Controlled 1 (TPT1) (AA 35-138) anticorps

Détails pour le produit réf. ABIN521072
Antigène
  • HRF
  • TCTP
  • p02
  • Trt
  • p21
  • p23
  • TPT1
  • TCT1
  • tctp
  • fa28a02
  • id:ibd2078
  • wu:fa28a02
  • PCHK23
  • hrf
  • MGC79720
  • Tpt1
  • translationally controlled tumor protein
  • CG4800
  • Dmel\\CG4800
  • dTCTP
  • Tctp
  • tumor protein, translationally-controlled 1
  • tumor protein, translationally-controlled 1 L homeolog
  • translationally-controlled tumor protein
  • translationally controlled tumor protein
  • translationally controlled tumor-like protein
  • Translationally controlled tumor protein
  • translationally-controlled tumor protein homolog
  • P23 tumor protein-like
  • TPT1
  • Tpt1
  • tpt1
  • tpt1.L
  • LOC711798
  • TCTP
  • LOC548038
  • Tctp
  • LOC108708523
  • LOC109404863
  • LOC105389397
  • LOC102577554
Épitope
AA 35-138
23
18
18
14
10
8
5
5
3
2
2
2
1
1
1
Reactivité
Humain
182
112
96
3
3
3
3
1
Hôte
Souris
178
18
Clonalité (Clone)
Monoclonal ()
Conjugué
Inconjugué
18
8
6
6
6
6
6
6
6
3
3
2
2
2
2
2
2
1
Application
ELISA, Western Blotting (WB)
139
79
50
31
30
29
15
13
11
8
7
3
3
2
2
2
Options
Fonction Mouse monoclonal antibody raised against a partial recombinant TPT1.
Immunogène

immunogen: TPT1 (AAH22436, 35 a.a. ~ 138 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: GVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC

Clone 2C4
Isotype IgG2a kappa
 Réactivité croisée Humain, Souris, Rat (Rattus)
Antigène
Autre désignation TPT1 (TPT1 Antibody Extrait)
Sujet Full Gene Name: tumor protein, translationally-controlled 1
Synonyms: FLJ27337,HRF,TCTP,p02
ID gène 7178
Pathways Response to Water Deprivation, Regulation of Cell Size, Negative Regulation of intrinsic apoptotic Signaling
Indications d'application Optimal working dilution should be determined by the investigator.
Commentaires

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Conseil sur la manipulation Aliquot to avoid repeated freezing and thawing.
Stock -20 °C
Stockage commentaire Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Tumor Protein, Translationally-Controlled 1 (TPT1) (AA 35-138) antibody (ABIN521072) Detection limit for recombinant GST tagged TPT1 is approximately 0.3ng/ml as a captur...
Image no. 2 for anti-Tumor Protein, Translationally-Controlled 1 (TPT1) (AA 35-138) antibody (ABIN521072) TPT1 monoclonal antibody (M03), clone 2C4. Western Blot analysis of TPT1 expression i...
Image no. 3 for anti-Tumor Protein, Translationally-Controlled 1 (TPT1) (AA 35-138) antibody (ABIN521072) TPT1 monoclonal antibody (M03), clone 2C4. Western Blot analysis of TPT1 expression i...
Image no. 4 for anti-Tumor Protein, Translationally-Controlled 1 (TPT1) (AA 35-138) antibody (ABIN521072) TPT1 monoclonal antibody (M03), clone 2C4. Western Blot analysis of TPT1 expression i...
Image no. 5 for anti-Tumor Protein, Translationally-Controlled 1 (TPT1) (AA 35-138) antibody (ABIN521072) TPT1 monoclonal antibody (M03), clone 2C4 Western Blot analysis of TPT1 expression in...
Produit citée dans: Sinthujaroen, Wanachottrakul, Pinkaew, Petersen, Phongdara, Sheffield-Moore, Fujise: "Elevation of serum fortilin levels is specific for apoptosis and signifies cell death in vivo." dans: BBA clinical, Vol. 2, pp. 103-111, 2015 (PubMed).

Avez-vous cherché autre chose?