Tel:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@anticorps-enligne.fr

RNASET2 anticorps (Ribonuclease T2) (AA 1-256) Primary Antibody

RNASET2 Reactivité: Humain WB Hôte: Souris Polyclonal unconjugated
N° du produit ABIN522084
$600.00
Plus shipping costs $45.00
50 μg
local_shipping Destination: Etats-Unis
Envoi sous 11 à 12 jours ouvrables
  • Antigène
    RNASET2
    Épitope
    AA 1-256
    • 15
    • 15
    • 9
    • 6
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    Reactivité
    Humain
    • 48
    • 20
    • 20
    • 1
    • 1
    • 1
    Hôte
    Souris
    • 48
    • 2
    Clonalité
    Polyclonal
    • 49
    • 1
    Conjugué
    Cet anticorp RNASET2 est non-conjugé
    • 19
    • 7
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Application
    Western Blotting (WB)
    • 38
    • 22
    • 21
    • 13
    • 9
    • 4
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    Fonction
    Mouse polyclonal antibody raised against a full-length human RNASET2 protein.
    Marque
    MaxPab®
     Réactivité croisée
    Humain
    Immunogène

    immunogen: RNASET2 (NP_003721.2, 1 a.a. ~ 256 a.a) full-length human protein.

    Immunogen Sequence: MRPAALRGALLGCLCLALLCLGGADKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPDKSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKH

  • Indications d'application
    Optimal working dilution should be determined by the investigator.
    Commentaires

    Product Quality tested by: Antibody reactive against mammalian transfected lysate.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Conseil sur la manipulation
    Aliquot to avoid repeated freezing and thawing.
    Stock
    -20 °C
    Stockage commentaire
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Antigène
    RNASET2
    Autre désignation
    RNASET2 (RNASET2 Antibody Extrait)
    Synonymes
    RNASE6PL, bA514O12.3, MGC83874, MGC145364, dre2, wu:fc10c06, zgc:113369, ribonuclease T2, ribonuclease T2 L homeolog, ribonuclease t2, RNASET2, Rnaset2, rnaset2.L, rnaset2, TM1040_2631, RPE_1409, Bind_1696, Dd586_2225, Nhal_0810, Snov_2442, Fbal_2689, Nitsa_0808, Mesop_3495
    Sujet
    Full Gene Name: ribonuclease T2
    Synonyms: RNASE6PL,bA514O12.3
    ID gène
    8635
    NCBI Accession
    NP_003721, NM_003730
Vous êtes ici:
help Support technique