POLQ anticorps (C-Term)

N° du produit ABIN5515979

Détail du produit anti-POLQ anticorps

Antigène: POLQ (Polymerase (DNA Directed), theta (POLQ))

Épitope: C-Term

Reactivité: Humain, Souris, Rat, Boeuf (Vache), Chien, Cobaye, Cheval, Lapin

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp POLQ est non-conjugé

Application: Western Blotting (WB)

Séquence: GHSFSFTSSDDIAEVLFLELKLPPNREMKNQGSKKTLGSTRRGIDNGRKL

Homologie: Cow: 93%, Dog: 93%, Guinea Pig: 86%, Horse: 93%, Human: 100%, Mouse: 93%, Rabbit: 86%, Rat: 100%

Attributs du produit: This is a rabbit polyclonal antibody against POLQ. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (< a href="mailto:info@avivasysbio.com">info@avivasysbio.com).

Purification: Affinity Purified

Immunogène: The immunogen is a synthetic peptide directed towards the C terminal region of human POLQ

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Restrictions: For Research Use only

Stockage

Format: Liquid

Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: -20 °C

Stockage commentaire: For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

Détails sur POLQ

Antigène: POLQ (Polymerase (DNA Directed), theta (POLQ))

Autre désignation: POLQ (POLQ Produits)

Synonymes: anticorps POLH, anticorps PRO0327, anticorps A430110D14Rik, anticorps DNA polymerase theta, anticorps polymerase (DNA directed), theta, anticorps POLQ, anticorps polq, anticorps LOC100179525, anticorps Polq

Sujet: POLQ belongs to the DNA polymerase type-A family. POLQ could be involved in the repair of interstrand cross-links.

Alias Symbols: DKFZp781A0112, POLH, PRO0327

Protein Interaction Partner: AP2S1,

Protein Size: 1762

ID gène: 10721

UniProt: O75417