LMO1 anticorps (C-Term)

N° du produit ABIN5518772

Détail du produit anti-LMO1 anticorps

Antigène: LMO1 (LIM Domain Only 1 (Rhombotin 1) (LMO1))

Épitope: AA 127-156, C-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LMO1 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Rhombotin-1(LMO1) detection. Tested with WB in Human,Mouse,Rat.

Séquence: DKFFLKNNMI LCQMDYEEGQ LNGTFESQVQ

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Rhombotin-1(LMO1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: LIM domain only 1
Protein Name: Rhombotin-1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human LMO1 (127-156aa DKFFLKNNMILCQMDYEEGQLNGTFESQVQ), different from the related mouse sequence by two amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur LMO1

Antigène: LMO1 (LIM Domain Only 1 (Rhombotin 1) (LMO1))

Autre désignation: LMO1 (LMO1 Produits)

Synonymes: anticorps DAT, anticorps Dat1, anticorps DAT1, anticorps PKDYS, anticorps RBTN1, anticorps RHOM1, anticorps TTG1, anticorps Lmo3, anticorps Rbtn-1, anticorps Rbtn1, anticorps Ttg1, anticorps LMO1, anticorps cb524, anticorps wu:fb76g02, anticorps zgc:109794, anticorps solute carrier family 6 (neurotransmitter transporter, dopamine), member 3, anticorps solute carrier family 6 member 3, anticorps LIM domain only 1, anticorps Rhombotin-1, anticorps Slc6a3, anticorps SLC6A3, anticorps LMO1, anticorps Lmo1, anticorps lmo1, anticorps rbtn1

Sujet: Rhombotin-1 is a protein that in humans is encoded by the LMO1 gene. This locus encodes a transcriptional regulator that contains two cysteine-rich LIM domains but lacks a DNA-binding domain. LIM domains may play a role in protein interactions, thus the encoded protein may regulate transcription by competitively binding to specific DNA-binding transcription factors. Alterations at this locus have been associated with acute lymphoblastic T-cell leukemia. Chromosomal rearrangements have been observed between this locus and at least two loci, the delta subunit of the T-cell antigen receptor gene and the LIM domain binding 1 gene. Alternatively spliced transcript variants have been described.

Synonyms: LMO1 | LMO-1 | LMO 1 | RBTN 1 | RBTN1 | RHOM 1 | RHOM1 | Rhombotin1 | Rhombotin-1 | Rhombotin 1 | TTG 1 | TTG1 | P25800

ID gène: 4004

UniProt: P25800

Pathways: Dopaminergic Neurogenesis