Nanog anticorps (Middle Region)

N° du produit ABIN5518779

Détail du produit anti-Nanog anticorps

Antigène: Nanog (NANOG) (Nanog Homeobox (NANOG))

Épitope: AA 115-155, Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Nanog est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Homeobox protein NANOG(NANOG) detection. Tested with WB in Human,Mouse,Rat.

Séquence: QRQKYLSLQQ MQELSNILNL SYKQVKTWFQ NQRMKSKRWQ K

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Homeobox protein NANOG(NANOG) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: Nanog homeobox
Protein Name: Homeobox protein NANOG

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human Nanog (115-155aa QRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQK), different from the related mouse sequence by three amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur Nanog

Antigène: Nanog (NANOG) (Nanog Homeobox (NANOG))

Autre désignation: NANOG (NANOG Produits)

Synonymes: anticorps 2410002E02Rik, anticorps ENK, anticorps ecat4, anticorps NANOG, anticorps hacp, anticorps wu:fd19e04, anticorps wu:fd20a07, anticorps zgc:193933, anticorps Nanog homeobox, anticorps nanog homeobox, anticorps Nanog, anticorps NANOG, anticorps nanog

Sujet: NANOG (pron. nanOg) is a transcription factor critically involved with self-renewal of undifferentiated embryonic stem cells. In humans, this protein is encoded by the NANOG gene. It is mapped to 12p13.31. NANOG is thought to be a key factor in maintaining pluripotency. Moreover, NANOG is also thought to function in concert with other factors such as POU5F1 (Oct-4) and SOX2 to establish ESC identity. The NANOG protein has been found to be a transcriptional activator for the Rex1 promoter, playing a key role in sustaining Rex1 expression. Knockdown of NANOG in embryonic stem cells results in a reduction of Rex1 expression, while forced expression of NANOG stimulates Rex1 expression.

Synonyms: ENK | NANOG | Q9H9S0

ID gène: 79923

UniProt: Q9H9S0

Pathways: Stem Cell Maintenance