Endoglin anticorps (Middle Region)

N° du produit ABIN5518816

Détail du produit anti-Endoglin anticorps

Antigène: Endoglin (ENG)

Épitope: AA 258-297, Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Endoglin est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Endoglin(ENG) detection. Tested with WB in Human,Mouse,Rat.

Séquence: YVSWLIDANH NMQIWTTGEY SFKIFPEKNI RGFKLPDTPQ

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Endoglin(ENG) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: endoglin
Protein Name: Endoglin

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human CD105 (258-297aa YVSWLIDANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQ), different from the related mouse sequence by twelve amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-Endoglin (ABIN5518816)

Ding, Chang, Niu, Dai, Geng, Li, Guo, Xu: "Overexpression of transcription factor Foxa2 and Hnf1α induced rat bone mesenchymal stem cells into hepatocytes." dans: Cytotechnology, Vol. 68, Issue 5, pp. 2037-47, (2016) (PubMed).

Zhang, Shang, Hao, Zheng, Li, Liang, Cui, Liu: "Effects of human umbilical cord mesenchymal stem cell transplantation combined with minimally invasive hematoma aspiration on intracerebral hemorrhage in rats." dans: American journal of translational research, Vol. 7, Issue 11, pp. 2176-86, (2016) (PubMed).

Yuan, Liu, Li, Li, Sun, Xu, Man, Fu: "Effects of BMSCs interactions with adventitial fibroblasts in transdifferentiation and ultrastructure processes." dans: International journal of clinical and experimental pathology, Vol. 7, Issue 7, pp. 3957-65, (2015) (PubMed).

Li, Zeng, Qi, Tang, Zhang, Wu, Liang, Shi, Liu, Zhang: "Xenotransplantation of human adipose-derived stem cells in zebrafish embryos." dans: PLoS ONE, Vol. 10, Issue 4, pp. e0123264, (2015) (PubMed).

Liu, Feng, Dong, Yang, Li, Chen, Zhang, Wang, Zhou, Zhao: "Administration of BMSCs with muscone in rats with gentamicin-induced AKI improves their therapeutic efficacy." dans: PLoS ONE, Vol. 9, Issue 5, pp. e97123, (2014) (PubMed).

Dai, Li, Zhou, Chen, Chen, Xiao: "Genistein promotion of osteogenic differentiation through BMP2/SMAD5/RUNX2 signaling." dans: International journal of biological sciences, Vol. 9, Issue 10, pp. 1089-98, (2013) (PubMed).

Ren, Ren, Zhao, Wang, Zuo, Yu: "Antitumor activity of endogenous mFlt4 displayed on a T4 phage nanoparticle surface." dans: Acta pharmacologica Sinica, Vol. 30, Issue 5, pp. 637-45, (2009) (PubMed).

Gracza: "[Molecular pharmacological investigation of medicinal plant substances. II. Inhibition of acetylcholinesterase by monoterpene derivatives in vitro]." dans: Zeitschrift fur Naturforschung. Section C, Biosciences, Vol. 40, Issue 3-4, pp. 151-3, (1985) (PubMed).

Détails sur Endoglin

Antigène: Endoglin (ENG)

Autre désignation: ENG (ENG Produits)

Synonymes: anticorps ENG, anticorps MGC137842, anticorps DKFZp469D0419, anticorps END, anticorps HHT1, anticorps ORW1, anticorps AI528660, anticorps AI662476, anticorps CD105, anticorps S-endoglin, anticorps endoglin, anticorps ENG, anticorps Eng

Sujet: Endoglin (Osler-Rendu-Weber syndrome 1), CD105, is a type I membrane glycoprotein located on cell surfaces and is a part of the TGF beta receptor complex. Its gene is mapped to human chromosome 8. The protein consists of a homodimer of 180 kDA with disulfide links. It has been found on endothelial cells, activated macrophages, fibroblasts and smooth muscle cells. Endoglin has a role in the development of the cardiovascular system and in vascular remodeling and has been found to be elevated in pregnant women who subsequently develop preeclampsia.

Synonyms: Endoglin | CD105 | ENG | END | P17813

ID gène: 2022

UniProt: P17813