CRX anticorps (C-Term)

N° du produit ABIN5518821

Détail du produit anti-CRX anticorps

Antigène: CRX (Cone-Rod Homeobox (CRX))

Épitope: AA 265-299, C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CRX est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Cone-rod homeobox protein(CRX) detection. Tested with WB in Human.

Séquence: DSLEFKDPTG TWKFTYNPMD PLDYKDQSAW KFQIL

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Cone-rod homeobox protein(CRX) detection. Tested with WB in Human.
Gene Name: cone-rod homeobox
Protein Name: Cone-rod homeobox protein

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human CORD2 (265-299aa DSLEFKDPTGTWKFTYNPMDPLDYKDQSAWKFQIL), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur CRX

Antigène: CRX (Cone-Rod Homeobox (CRX))

Autre désignation: CRX (CRX Produits)

Synonymes: anticorps Xotx5, anticorps Xotx5b, anticorps cord2, anticorps crd, anticorps otx5, anticorps otx5b, anticorps rx, anticorps CRX, anticorps crx, anticorps otx5-b, anticorps CORD2, anticorps CRD, anticorps LCA7, anticorps OTX3, anticorps Crx1, anticorps otx5-A, anticorps cone-rod homeobox, anticorps cone-rod homeobox L homeolog, anticorps cone-rod homeobox S homeolog, anticorps crx, anticorps CRX, anticorps Crx, anticorps crx.L, anticorps crx.S

Sujet: Cone-rod homeobox protein is a protein that in humans is encoded by the CRX gene. The protein encoded by this gene is a photoreceptor-specific transcription factor which plays a role in the differentiation of photoreceptor cells. This homeodomain protein is necessary for the maintenance of normal cone and rod function. Mutations in this gene are associated with photoreceptor degeneration, Leber congenital amaurosis type III and the autosomal dominant cone-rod dystrophy 2. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some variants has not been determined.

Synonyms: CORD 2 | CRD | CRX | LCA 7 | LCA7 | OTX 3 | OTX3 | O43186

ID gène: 1406

UniProt: O43186