DVL2 anticorps (N-Term)

N° du produit ABIN5518826

Détail du produit anti-DVL2 anticorps

Antigène: DVL2 (Dishevelled, Dsh Homolog 2 (Drosophila) (DVL2))

Épitope: AA 35-64, N-Term

Reactivité: Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DVL2 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Segment polarity protein dishevelled homolog DVL-2(DVL2) detection. Tested with WB in Human,Mouse,Rat.

Séquence: AERITLGDFK SVLQRPAGAK YFFKSMDQDF

Réactivité croisée (Details): Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.

Attributs du produit: Rabbit IgG polyclonal antibody for Segment polarity protein dishevelled homolog DVL-2(DVL2) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: dishevelled segment polarity protein 2
Protein Name: Segment polarity protein dishevelled homolog DVL-2

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human Dishevelled 2 (35-64aa AERITLGDFKSVLQRPAGAKYFFKSMDQDF), identical to the related mouse sequence.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur DVL2

Antigène: DVL2 (Dishevelled, Dsh Homolog 2 (Drosophila) (DVL2))

Autre désignation: DVL2 (DVL2 Produits)

Synonymes: anticorps Xdsh, anticorps dishevelled, anticorps dsh, anticorps dvl, anticorps Dvl-2, anticorps xdsh, anticorps wu:fc05d12, anticorps wu:fo71e09, anticorps wu:fp54a02, anticorps zgc:55372, anticorps dishevelled segment polarity protein 2, anticorps dishevelled segment polarity protein 2 L homeolog, anticorps DVL2, anticorps dvl2, anticorps Dvl2, anticorps dvl2.L

Sujet: Segment polarity protein dishevelled homolog DVL-2 is a protein that in humans is encoded by the DVL2 gene. This gene encodes a member of the dishevelled (dsh) protein family. The vertebrate dsh proteins have approximately 40 % amino acid sequence similarity with Drosophila dsh. This gene encodes a 90-kD protein that undergoes posttranslational phosphorylation to form a 95-kD cytoplasmic protein, which may play a role in the signal transduction pathway mediated by multiple Wnt proteins. The mechanisms of dishevelled function in Wnt signaling are likely to be conserved among metazoans.

Synonyms: Dishevelled-2 | Dishevelled2 | DSH homolog 2 | DVL 2 | Dvl2 | O14641

ID gène: 1856

UniProt: O14641

Pathways: Tube Formation