OTC anticorps (N-Term)

N° du produit ABIN5518860

Détail du produit anti-OTC anticorps

Antigène: OTC (Ornithine Carbamoyltransferase (OTC))

Épitope: AA 33-70, N-Term

Reactivité: Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OTC est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Ornithine carbamoyltransferase, mitochondrial(OTC) detection. Tested with WB in Human,Mouse,Rat.

Séquence: NKVQLKGRDL LTLKNFTGEE IKYMLWLSAD LKFRIKQK

Réactivité croisée (Details): Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.

Attributs du produit: Rabbit IgG polyclonal antibody for Ornithine carbamoyltransferase, mitochondrial(OTC) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: ornithine carbamoyltransferase
Protein Name: Ornithine carbamoyltransferase, mitochondrial

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human OTC (33-70aa NKVQLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQK), different from the related mouse and rat sequences by three amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur OTC

Antigène: OTC (Ornithine Carbamoyltransferase (OTC))

Autre désignation: OTC (OTC Produits)

Synonymes: anticorps OCTD, anticorps 2810428A13Rik, anticorps AA589422, anticorps AW457381, anticorps OCT, anticorps Plxn2, anticorps mKIAA0463, anticorps F1B16.13, anticorps F1B16_13, anticorps ORNITHINE CARBAMOYLTRANSFERASE, anticorps ornithine carbamoyltransferase, anticorps BA4351, anticorps PSPTO4164, anticorps PLXN2, anticorps AI265390, anticorps Sf, anticorps spf, anticorps si:dkey-19h21.3, anticorps ornithine carbamoyltransferase, anticorps plexin A2, anticorps ornithine carbamoyltransferase ArgF, anticorps ornithine transcarbamylase, anticorps OTC, anticorps Plxna2, anticorps Otc, anticorps argF, anticorps argF-2, anticorps atpD-2, anticorps CNC04300, anticorps PLXNA2, anticorps otc

Sujet: Ornithine transcarbamylase (OTC) (also called ornithine carbamoyltransferase) is an enzyme that catalyzes the reaction between carbamoyl phosphate (CP) and ornithine (Orn) to form citrulline (Cit) and phosphate (Pi). This nuclear gene encodes a mitochondrial matrix enzyme. Missense, nonsense, and frameshift mutations in this enzyme lead to ornithine transcarbamylase deficiency, which causes hyperammonemia. Since the gene for this enzyme maps close to that for Duchenne muscular dystrophy, it may also play a role in that disease.

Synonyms: OCTD | Otc | OTCase | P00480

ID gène: 5009

UniProt: P00480