TIMP3 anticorps (Middle Region)

N° du produit ABIN5518878

Détail du produit anti-TIMP3 anticorps

Antigène: TIMP3 (TIMP Metallopeptidase Inhibitor 3 (TIMP3))

Épitope: AA 107-141, Middle Region

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TIMP3 est non-conjugé

Application: Western Blotting (WB), ELISA

Fonction: Rabbit IgG polyclonal antibody for Metalloproteinase inhibitor 3(TIMP3) detection. Tested with WB, ELISA in Human,Mouse,Rat.

Séquence: RVYDGKMYTG LCNFVERWDQ LTLSQRKGLN YRYHL

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Metalloproteinase inhibitor 3(TIMP3) detection. Tested with WB, ELISA in Human,Mouse,Rat.
Gene Name: TIMP metallopeptidase inhibitor 3
Protein Name: Metalloproteinase inhibitor 3

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human TIMP3 (107-141aa RVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHL), different from the related mouse and rat sequences by two amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Human

Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-TIMP3 (ABIN5518878)

Guan, Zhang, Song, Dai: "Promoter methylation and expression of TIMP3 gene in gastric cancer." dans: Diagnostic pathology, Vol. 8, pp. 110, (2014) (PubMed).

Bai, Yi, Li, Sui: "Clinicopathologic significance of BAG1 and TIMP3 expression in colon carcinoma." dans: World journal of gastroenterology, Vol. 13, Issue 28, pp. 3883-5, (2007) (PubMed).

Détails sur TIMP3

Antigène: TIMP3 (TIMP Metallopeptidase Inhibitor 3 (TIMP3))

Autre désignation: TIMP3 (TIMP3 Produits)

Synonymes: anticorps TIMP-3, anticorps TIMP3, anticorps timp3, anticorps HSMRK222, anticorps K222, anticorps K222TA2, anticorps SFD, anticorps IMP-3, anticorps timp3-A, anticorps Timp-3, anticorps metalloproteinase inhibitor 3, anticorps TIMP metallopeptidase inhibitor 3, anticorps Metalloproteinase inhibitor 3, anticorps TIMP metallopeptidase inhibitor 3 L homeolog, anticorps tissue inhibitor of metalloproteinase 3, anticorps CpipJ_CPIJ003282, anticorps TIMP3, anticorps timp3, anticorps Timp3, anticorps timp3.L

Sujet: Metalloproteinase inhibitor 3 is a protein that in humans is encoded by the TIMP3 gene. It is mapped to 22q12.1-q13.2. This gene belongs to the tissue inhibitor of metalloproteinases gene family. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of theextracellular matrix (ECM). Expression of this gene is induced in response to mitogenic stimulation and this netrin domain-containing protein is localized to the ECM. Mutations in this gene have been associated with the autosomal dominant disorder Sorsby's fundus dystrophy.

Synonyms: Metalloproteinase inhibitor 3 | Protein MIG-5 | Tissue inhibitor of metalloproteinases 3 | TIMP-3 | TIMP3 | P35625

ID gène: 7078

UniProt: P35625