ATOH1 anticorps (N-Term)

N° du produit ABIN5518893

Détail du produit anti-ATOH1 anticorps

Antigène: ATOH1 (Atonal Homolog 1 (Drosophila) (ATOH1))

Épitope: AA 1-30, N-Term

Reactivité: Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATOH1 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Protein atonal homolog 1(ATOH1) detection. Tested with WB in Human,Mouse,Rat.

Séquence: MSRLLHAEEW AEVKELGDHH RQPQPHHLPQ

Réactivité croisée (Details): Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.

Attributs du produit: Rabbit IgG polyclonal antibody for Protein atonal homolog 1(ATOH1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: atonal bHLH transcription factor 1
Protein Name: Protein atonal homolog 1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human MATH1/HATH1 (1-30aa MSRLLHAEEWAEVKELGDHHRQPQPHHLPQ), different from the related mouse sequence by three amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur ATOH1

Antigène: ATOH1 (Atonal Homolog 1 (Drosophila) (ATOH1))

Autre désignation: ATOH1 (ATOH1 Produits)

Synonymes: anticorps Atoh1.1, anticorps ZATH-1, anticorps ath1, anticorps atoh1, anticorps zath1, anticorps zgc:136417, anticorps CATH1, anticorps Atoh1.2, anticorps Tath1, anticorps ATOH1, anticorps ATH1, anticorps HATH1, anticorps MATH-1, anticorps bHLHa14, anticorps Hath1, anticorps Math1, anticorps RGD1565171, anticorps atonal bHLH transcription factor 1a, anticorps atonal homolog 1 (Drosophila), anticorps atonal bHLH transcription factor 1b, anticorps absent MD neurons and olfactory sensilla, anticorps atonal bHLH transcription factor 1, anticorps atoh1a, anticorps ATOH1, anticorps atoh1b, anticorps LOC663144, anticorps Atoh1

Sujet: Protein atonal homolog 1 is a protein that in humans is encoded by the ATOH1 gene. This protein belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47. ATOH1 is required for the formation of both neural and non-neural cell types. Using genetic deletion in mice, Atoh1 has been shown to be essential for formation of cerebellar granule neurons, inner ear hair cells, spinal cord interneurons, Merkel cells of the skin, and intestinal secretory cells (goblet, enteroendocrine, and Paneth cells).

Synonyms: Protein atonal homolog 1, Class A basic helix-loop-helix protein 14, bHLHa14, Helix-loop-helix protein hATH-1, hATH1, ATOH1, ATH1, BHLHA14, MATH 1, MATH1

ID gène: 474

UniProt: Q92858