XPO5 anticorps (N-Term)

N° du produit ABIN5518968

Détail du produit anti-XPO5 anticorps

Antigène: XPO5 (Exportin 5 (XPO5))

Épitope: AA 2-43, N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp XPO5 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Exportin-5(XPO5) detection. Tested with WB in Human,Mouse,Rat.

Séquence: AMDQVNALCE QLVKAVTVMM DPNSTQRYRL EALKFCEEFK EK

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Exportin-5(XPO5) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: exportin 5
Protein Name: Exportin-5

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human Exportin-5 (2-43aa AMDQVNALCEQLVKAVTVMMDPNSTQRYRLEALKFCEEFKEK), different from the related mouse sequence by four amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur XPO5

Antigène: XPO5 (Exportin 5 (XPO5))

Autre désignation: XPO5 (XPO5 Produits)

Synonymes: anticorps exp5, anticorps CG12234, anticorps Dmel\\CG12234, anticorps Exp-5, anticorps Exp5, anticorps RanBP21, anticorps dmExp5, anticorps 2410004H11Rik, anticorps 2700038C24Rik, anticorps AI648907, anticorps AW549301, anticorps RanBp21, anticorps mKIAA1291, anticorps exportin-5, anticorps ranbp21, anticorps DDBDRAFT_0185980, anticorps DDBDRAFT_0237583, anticorps DDB_0185980, anticorps DDB_0237583, anticorps XPO5, anticorps exportin 5, anticorps CG12234 gene product from transcript CG12234-RB, anticorps armadillo-like helical domain-containing protein, anticorps XPO5, anticorps Ranbp21, anticorps Xpo5, anticorps xpo5

Sujet: Exportin-5 (XPO5) is a protein that in humans is encoded by the XPO5 gene. The International Radiation Hybrid Mapping Consortium mapped the XPO5 gene to chromosome 6. This gene encodes a member of the karyopherin family that is required for the transport of small RNAs and double-stranded RNA-binding proteins from the nucleus to the cytoplasm. The encoded protein translocates cargo through the nuclear pore complex in a RanGTP-dependent process.

Synonyms: Exportin-5, Exp5, Ran-binding protein 21, XPO5, KIAA1291, RANBP21

ID gène: 57510

Pathways: Regulatory RNA Pathways, Protein targeting to Nucleus