FH anticorps

N° du produit ABIN5518986

Détail du produit anti-FH anticorps

Antigène: FH (Fumarate Hydratase (FH))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FH est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for FH detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: YDKAAKIAKT AHKNGSTLKE TAIELGYLTA EQFDEWVKPK DMLGPK

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for FH detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: fumarate hydratase
Protein Name: Fumarate hydratase, mitochondrial

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence of human FH (YDKAAKIAKTAHKNGSTLKETAIELGYLTAEQFDEWVKPKDMLGPK).

Isotype: IgG

Information d'application

Indications d'application: Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur FH

Antigène: FH (Fumarate Hydratase (FH))

Autre désignation: FH (FH Produits)

Synonymes: anticorps FH, anticorps DDBDRAFT_0205237, anticorps DDBDRAFT_0231397, anticorps DDBDRAFT_0231400, anticorps DDB_0205237, anticorps DDB_0231397, anticorps DDB_0231400, anticorps HLRCC, anticorps LRCC, anticorps MCL, anticorps MCUL1, anticorps Fh1, anticorps im:7152785, anticorps ns:zf-e152, anticorps zf-e152, anticorps zgc:66253, anticorps zgc:77498, anticorps Fh, anticorps Fh-1, anticorps fumarate hydratase, anticorps fumarate hydratase 1, anticorps FH, anticorps fumH, anticorps Fh, anticorps fh, anticorps Fh1

Sujet: Fumarase (or fumaratehydratase) is an enzyme that catalyzes the reversible hydration/dehydration of fumarate to malate. Fumarase comes in two forms: mitochondrial and cytosolic. The mitochondrial isoenzyme is involved in the Krebs Cycle (also known as the Tricarboxylic Acid Cycle [TCA] or the Citric Acid Cycle), and the cytosolic isoenzyme is involved in the metabolism of amino acids and fumarate. Subcellular localization is established by the presence of a signal sequence on the amino terminus in the mitochondrial form, while subcellular localization in the cytosolic form is established by the absence of the signal sequence found in the mitochondrial variety. This enzyme participates in 2 metabolic pathways: citric acid cycle, reductive citric acid cycle (CO2 fixation), and is also important in renal cell carcinoma. Mutations in this gene have been associated with the development of leiomyomas in the skin and uterus in combination with renal cell carcinoma.

Synonyms: Fumarate hydratase, mitochondrial, Fumarase, FH,

ID gène: 2271

UniProt: P07954