Integrin alpha 3b anticorps (Cytoplasmic Domain, N-Term)

N° du produit ABIN5621198

Cet anticorps Souris Monoclonal détecte spécifiquement Integrin alpha 3b dans IHC, WB et IHC (fro). Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour Integrin alpha 3b anticorps (Cytoplasmic Domain, N-Term) (ABIN5621198)

Antigène: Integrin alpha 3b

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp Integrin alpha 3b est non-conjugé

Application: Immunohistochemistry (IHC), Western Blotting (WB), Immunohistochemistry (Frozen Sections) (IHC (fro))

Clone: 54B3

Détail du produit anti-Integrin alpha 3b anticorps

Épitope: Cytoplasmic Domain, N-Term

Specificité: Recognizes specifically the cytoplasmic domain of integrin subunit alpha3B which is present in microvascular structures in brain and heart

Réactivité croisée (Details): Human

Attributs du produit: Mouse monoclonal Integrin alpha 3B antibody

Immunogène: Integrin alpha 3B antibody was raised in Mouse using a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin as the immunogen.

Isotype: IgG1

Information d'application

Indications d'application: IHC: 1:25-1:200, WB: 1:100-1:1000

Restrictions: For Research Use only

Stockage

Buffer: Supplied in PBS containing 0.09 % sodium azide

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C

Détails sur Integrin alpha 3b

Antigène: Integrin alpha 3b