Tel:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@anticorps-enligne.fr

VSNL1 anticorps (Visinin-Like 1) (AA 1-191) Primary Antibody

VSNL1 Reactivité: Humain ELISA, WB Hôte: Souris Monoclonal 2F1-E3 unconjugated
N° du produit ABIN563380
$440.00
Plus shipping costs $45.00
100 μg
local_shipping Destination: Etats-Unis
Envoi sous 11 à 12 jours ouvrables
  • Antigène
    VSNL1
    Épitope
    AA 1-191
    • 16
    • 11
    • 9
    • 8
    • 8
    • 8
    • 8
    • 4
    • 3
    • 2
    • 2
    • 2
    Reactivité
    Humain
    • 80
    • 41
    • 20
    • 6
    • 1
    Hôte
    Souris
    Clonalité
    Monoclonal
    Conjugué
    Cet anticorp VSNL1 est non-conjugé
    • 45
    • 6
    • 5
    • 5
    • 5
    • 4
    • 4
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Application
    ELISA, Western Blotting (WB)
    • 66
    • 47
    • 38
    • 21
    • 13
    • 10
    • 9
    • 5
    • 2
    • 1
    • 1
    • 1
    • 1
    Fonction
    Mouse monoclonal antibody raised against a full length recombinant VSNL1.
     Réactivité croisée
    Humain
    Immunogène

    immunogen: VSNL1 (AAH22012, 1 a.a. ~ 191 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK

    Clone
    2F1-E3
    Isotype
    IgG2a kappa
  • Indications d'application
    Optimal working dilution should be determined by the investigator.
    Commentaires

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Conseil sur la manipulation
    Aliquot to avoid repeated freezing and thawing.
    Stock
    -20 °C
    Stockage commentaire
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Antigène
    VSNL1
    Autre désignation
    VSNL1 (VSNL1 Antibody Extrait)
    Synonymes
    HLP3, HPCAL3, HUVISL1, VILIP, VILIP-1, Nvp1, Ratnvp1, Vnsl1, MGC132057, MGC146004, VSNL1, si:dkey-15f12.11, si:dkey-30j22.11, zgc:103644, hlp3, vilip, hpcal3, huvisl1, vilip-1, visinin like 1, visinin-like 1, visinin like 1 S homeolog, visinin-like 1a, visinin like 1 L homeolog, VSNL1, Vsnl1, vsnl1.S, vsnl1, vsnl1a, vsnl1.L
    Sujet
    Full Gene Name: visinin-like 1
    Synonyms: HLP3,HPCAL3,HUVISL1,VILIP,VILIP-1
    ID gène
    7447
Vous êtes ici:
help Support technique