MPHOSPH6 anticorps (M-Phase phosphoprotein 6) (AA 1-160)

Details for Product anti-MPHOSPH6 Antibody No. ABIN564411
Antigène
  • MPP
  • MPP-6
  • MPP6
  • BcDNA:RE45276
  • CG9250
  • Dmel\\CG9250
  • Mpps
  • dMPP6
  • l(2)k16403
  • mpp6
  • zgc:100960
  • GB17036
  • 1110001M01Rik
  • AA536809
  • C86426
  • mphosph6
  • M-phase phosphoprotein 6
  • M phase phosphoprotein 6
  • M-phase phosphoprotein 6 L homeolog
  • MPHOSPH6
  • Mpp6
  • mphosph6
  • LOC726279
  • CpipJ_CPIJ011661
  • Bm1_48075
  • Mphosph6
  • mphosph6.L
Épitope
AA 1-160
16
8
6
2
Reactivité
Humain
30
4
4
Hôte
Souris
22
7
1
Clonalité (Clone)
Monoclonal ()
Conjugué
Cet anticorp MPHOSPH6 est non-conjugé
2
2
2
2
2
2
Application
ELISA, Western Blotting (WB)
30
23
4
3
1
Options
Fonction Mouse monoclonal antibody raised against a full length recombinant MPHOSPH6.
Immunogène

immunogen: MPHOSPH6 (AAH05242, 1 a.a. ~ 160 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: MAAERKTKLSKNLLRMKFMQRGLDSETKKQLEEEEKKIISEEHWYLDLPELKEKESFIIEEQSFLLCEDLLYGRMSFRGFNPEVEKLMLQMNAKHKAEEVEDETVELDVSDEEMARRYETLVGTIGKKFARKRDHANYEEDENGDITPIKAKKMFLKPQD

Clone 1D8-2A8
Isotype IgG1 kappa
 Réactivité croisée Humain
Plasmids, Primers & others Plasmids, Primers & others MPHOSPH6 products on genomics-online (e.g. as negative or positive controls)
Antigène
Autre désignation MPHOSPH6 (MPHOSPH6 Antibody Extrait)
Sujet Full Gene Name: M-phase phosphoprotein 6
Synonyms: MPP,MPP-6,MPP6
ID gène 10200
Pathways M Phase
Indications d'application Optimal working dilution should be determined by the investigator.
Commentaires

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Conseil sur la manipulation Aliquot to avoid repeated freezing and thawing.
Stock -20 °C
Stockage commentaire Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-M-Phase phosphoprotein 6 (MPHOSPH6) (AA 1-160) antibody (ABIN564411) Detection limit for recombinant GST tagged MPHOSPH6 is approximately 0.1ng/ml as a ca...
Image no. 2 for anti-M-Phase phosphoprotein 6 (MPHOSPH6) (AA 1-160) antibody (ABIN564411) Western Blot detection against Immunogen (43.34 KDa) .
Image no. 3 for anti-M-Phase phosphoprotein 6 (MPHOSPH6) (AA 1-160) antibody (ABIN564411) MPHOSPH6 monoclonal antibody (M01), clone 1D8-2A8 Western Blot analysis of MPHOSPH6 e...
Avez-vous cherché autre chose?