Adenylate Kinase 1 anticorps (AA 149-189)

N° du produit ABIN5647008

Cet anticorps Lapin Polyclonal détecte spécifiquement Adenylate Kinase 1 dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour Adenylate Kinase 1 anticorps (AA 149-189) (ABIN5647008)

Antigène: Adenylate Kinase 1 (AK1)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Adenylate Kinase 1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Adenylate Kinase 1 anticorps

Épitope: AA 149-189

Purification: Antigen affinity purified

Immunogène: Amino acids 149-189 (RLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTH) from the human protein were used as the immunogen for the AK1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the AK1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur Adenylate Kinase 1

Antigène: Adenylate Kinase 1 (AK1)

Autre désignation: AK1 / Adenylate Kinase 1

Sujet: This gene encodes an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments. This gene is highly expressed in skeletal muscle, brain and erythrocytes. Certain mutations in this gene resulting in a functionally inadequate enzyme are associated with a rare genetic disorder causing nonspherocytic hemolytic anemia. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.

UniProt: P00568

Pathways: Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process