ALDH1B1 anticorps (AA 116-156)

N° du produit ABIN5647015

L’anticorps anti-ALDH1B1 Polyclonal Lapin est utilisé pour la détection de ALDH1B1 dans des échantillons de Humain, Rat, Souris et Singe. Il a été validé pour WB, IF, FACS et IHC (p).

Aperçu rapide pour ALDH1B1 anticorps (AA 116-156) (ABIN5647015)

Antigène: ALDH1B1 (Aldehyde Dehydrogenase 1 Family, Member B1 (ALDH1B1))

Reactivité: Humain, Rat, Souris, Singe

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ALDH1B1 est non-conjugé

Application: Western Blotting (WB), Immunofluorescence (IF), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-ALDH1B1 anticorps

Épitope: AA 116-156

Fonction: ALDH1B1 Antibody

Purification: Antigen affinity

Immunogène: Amino acids 116-156 (RVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADKW from the human protein were used as the immunogen for the ALDH1B1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Differences in protocols and secondary/substrate sensitivity may require the ALDH1B1 antibody to be titrated for optimal performance.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the ALDH1B1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur ALDH1B1

Antigène: ALDH1B1 (Aldehyde Dehydrogenase 1 Family, Member B1 (ALDH1B1))

Autre désignation: ALDH1B1

Sujet: Aldehyde dehydrogenase X, mitochondrial is an enzyme that in humans is encoded by the ALDH1B1 gene. This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems.

UniProt: P30837