ALDH1B1 anticorps (AA 116-156)

N° du produit ABIN5647015

Détail du produit anti-ALDH1B1 anticorps

Antigène: ALDH1B1 (Aldehyde Dehydrogenase 1 Family, Member B1 (ALDH1B1))

Épitope: AA 116-156

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ALDH1B1 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogène: Amino acids 116-156 (RVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADKW from the human protein were used as the immunogen for the ALDH1B1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the ALDH1B1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur ALDH1B1

Antigène: ALDH1B1 (Aldehyde Dehydrogenase 1 Family, Member B1 (ALDH1B1))

Autre désignation: ALDH1B1 (ALDH1B1 Produits)

Synonymes: anticorps ALDH5, anticorps ALDHX, anticorps rf2d, anticorps 2700007F14Rik, anticorps aldehyde dehydrogenase 1 family member B1, anticorps aldehyde dehydrogenase 5, anticorps aldehyde dehydrogenase 1 family, member B1, anticorps aldehyde dehydrogenase 3B1, anticorps hypothetical protein, anticorps ALDH1B1, anticorps aldh5, anticorps Aldh1b1, anticorps MCYG_01035, anticorps MGYG_00956, anticorps PGTG_20239

Sujet: Aldehyde dehydrogenase X, mitochondrial is an enzyme that in humans is encoded by the ALDH1B1 gene. This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems.

UniProt: P30837