Annexin VIII anticorps (AA 20-61)

N° du produit ABIN5647020

Détail du produit anti-Annexin VIII anticorps

Antigène: Annexin VIII (ANXA8) (Annexin A8 (ANXA8))

Épitope: AA 20-61

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Annexin VIII est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogène: Amino acids 20-61 (HFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAK) from the human protein were used as the immunogen for the Annexin VIII antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the Annexin VIII antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the Annexin VIII antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur Annexin VIII

Antigène: Annexin VIII (ANXA8) (Annexin A8 (ANXA8))

Autre désignation: Annexin VIII (ANXA8 Produits)

Synonymes: anticorps ANX8, anticorps ANXA8L1, anticorps ANXA8L2, anticorps AI466995, anticorps Anx8, anticorps anx8, anticorps MGC85309, anticorps ANXA8, anticorps annexin A8, anticorps annexin A8 S homeolog, anticorps ANXA8, anticorps Anxa8, anticorps anxa8.S, anticorps LOC694628, anticorps LOC100052045

Sujet: ANXA8 is also known as Annexin VIII. This gene encodes a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The encoded protein may function as an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.

UniProt: P13928