ACTN3 anticorps (AA 574-617)

N° du produit ABIN5647038

Cet anticorps Lapin Polyclonal détecte spécifiquement ACTN3 dans WB, IF, IHC (p) et FACS. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour ACTN3 anticorps (AA 574-617) (ABIN5647038)

Antigène: ACTN3 (Actinin, alpha 3 (ACTN3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACTN3 est non-conjugé

Application: Western Blotting (WB), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Détail du produit anti-ACTN3 anticorps

Épitope: AA 574-617

Fonction: ACTN3 Antibody

Séquence: EADRERGAIM GIQGEIQKIC QTYGLRPCST NPYITLSPQD INTK

Purification: Antigen affinity

Immunogène: Amino acids 574-617 (EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTK) from the human protein were used as the immunogen for the ACTN3 antibody.

Isotype: IgG

Information d'application

Indications d'application: Differences in protocols and secondary/substrate sensitivity may require the ACTN3 antibody to be titrated for optimal performance.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the ACTN3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur ACTN3

Antigène: ACTN3 (Actinin, alpha 3 (ACTN3))

Autre désignation: ACTN3

Sujet: Alpha-actinin-3, also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein, is a protein that in humans is encoded by the ACTN3 gene. This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants, the reference genome represents the coding allele. The non-functional allele of this gene is associated with elite athlete status.

UniProt: Q08043

Pathways: Cell-Cell Junction Organization