BDKRB2 anticorps (AA 357-391)

N° du produit ABIN5647061

Cet anticorps anti-BDKRB2 est un anticorps Lapin Polyclonal détectant BDKRB2 dans WB. Adapté pour Humain.

Aperçu rapide pour BDKRB2 anticorps (AA 357-391) (ABIN5647061)

Antigène: BDKRB2 (Bradykinin Receptor B2 (BDKRB2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BDKRB2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-BDKRB2 anticorps

Épitope: AA 357-391

Purification: Antigen affinity purified

Immunogène: Amino acids 357-391 (RSEPIQMENSMGTLRTSISVERQIHKLQDWAGSRQ) from the human protein were used as the immunogen for the BDKRB2 antibody.

Isotype: IgG

Information d'application

Indications d'application: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the BDKRB2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur BDKRB2

Antigène: BDKRB2 (Bradykinin Receptor B2 (BDKRB2))

Autre désignation: BDKRB2

Sujet: Bradykinin receptor B2 is a G-protein coupled receptor forbradykinin, encoded by the BDKRB2 gene in humans. This gene encodes a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system. Alternate start codons result in two isoforms of the protein.

UniProt: P30411

Pathways: ACE Inhibitor Pathway, Negative Regulation of intrinsic apoptotic Signaling