BDKRB2 anticorps (AA 357-391)
-
- Antigène Voir toutes BDKRB2 Anticorps
- BDKRB2 (Bradykinin Receptor B2 (BDKRB2))
-
Épitope
- AA 357-391
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp BDKRB2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Antigen affinity purified
- Immunogène
- Amino acids 357-391 (RSEPIQMENSMGTLRTSISVERQIHKLQDWAGSRQ) from the human protein were used as the immunogen for the BDKRB2 antibody.
- Isotype
- IgG
- Top Product
- Discover our top product BDKRB2 Anticorps primaire
-
-
- Indications d'application
- Western blot: 0.5-1 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Stock
- -20 °C
- Stockage commentaire
- After reconstitution, the BDKRB2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Antigène
- BDKRB2 (Bradykinin Receptor B2 (BDKRB2))
- Autre désignation
- BDKRB2 (BDKRB2 Produits)
- Synonymes
- anticorps BDKRB2, anticorps b2r, anticorps bk2, anticorps bk-2, anticorps bkr2, anticorps brb2, anticorps kinrec, anticorps B2R, anticorps BK-2, anticorps BK2, anticorps BKR2, anticorps BRB2, anticorps B2BKR, anticorps B2BRA, anticorps B(2), anticorps B2, anticorps BK2R, anticorps Bdkrb2, anticorps bradykinin receptor B2, anticorps bradykinin receptor, beta 2, anticorps bradykinin type 2 receptor, anticorps Bdkrb2, anticorps BDKRB2, anticorps bdkrb2, anticorps kinrec, anticorps B2R
- Sujet
- Bradykinin receptor B2 is a G-protein coupled receptor forbradykinin, encoded by the BDKRB2 gene in humans. This gene encodes a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system. Alternate start codons result in two isoforms of the protein.
- UniProt
- P30411
- Pathways
- ACE Inhibitor Pathway, Negative Regulation of intrinsic apoptotic Signaling
-