IFNGR1 anticorps (AA 108-147)

N° du produit ABIN5647066

L’anticorps anti-IFNGR1 Polyclonal Lapin est utilisé pour la détection de IFNGR1 dans des échantillons de Humain. Il a été validé pour WB et FACS.

Aperçu rapide pour IFNGR1 anticorps (AA 108-147) (ABIN5647066)

Antigène: IFNGR1 (Interferon gamma Receptor 1 (IFNGR1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IFNGR1 est non-conjugé

Application: Western Blotting (WB), Flow Cytometry (FACS)

Détail du produit anti-IFNGR1 anticorps

Épitope: AA 108-147

Fonction: CD119 Antibody / IFNGR1

Séquence: QKESAYAKSE EFAVCRDGKI GPPKLDIRKE EKQIMIDIFH

Purification: Antigen affinity

Immunogène: Amino acids 108-147 (QKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFH) from the human protein were used as the immunogen for the CD119 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the CD119 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the CD119 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur IFNGR1

Antigène: IFNGR1 (Interferon gamma Receptor 1 (IFNGR1))

Autre désignation: CD119

Sujet: Interferon gamma receptor 1 (IFNGR1), also known as CD119 (Cluster of Differentiation 119), is a protein that in humans is encoded by the IFNGR1 gene. This gene encodes the ligand-binding chain (alpha) of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection.

UniProt: P15260

Pathways: Interferon-gamma Pathway