IFNGR1 anticorps (AA 443-484)

N° du produit ABIN5647067

Cet anticorps anti-IFNGR1 est un anticorps Lapin Polyclonal détectant IFNGR1 dans WB et FACS. Adapté pour Humain.

Aperçu rapide pour IFNGR1 anticorps (AA 443-484) (ABIN5647067)

Antigène: IFNGR1 (Interferon gamma Receptor 1 (IFNGR1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IFNGR1 est non-conjugé

Application: Western Blotting (WB), Flow Cytometry (FACS)

Détail du produit anti-IFNGR1 anticorps

Épitope: AA 443-484

Purification: Antigen affinity purified

Immunogène: Amino acids 443-484 (QELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIGYRPTED) from the human protein were used as the immunogen for the IFNGR1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the IFNGR1 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL, FACS: 1-3 μg/10^6 cells

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the IFNGR1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur IFNGR1

Antigène: IFNGR1 (Interferon gamma Receptor 1 (IFNGR1))

Autre désignation: IFNGR1 / CD119

Sujet: Interferon gamma receptor 1 (IFNGR1), also known as CD119 (Cluster of Differentiation 119), is a protein that in humans is encoded by the IFNGR1 gene. This gene encodes the ligand-binding chain (alpha) of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection.

UniProt: P15260

Pathways: Interferon-gamma Pathway