Superoxide dismutase copper chaperone anticorps (AA 174-209)

N° du produit ABIN5647094

Cet anticorps anti-Superoxide dismutase copper chaperone Polyclonal Lapin (ABIN5647094) détecte spécifiquement Superoxide dismutase copper chaperone dans WB et IHC (p). L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour Superoxide dismutase copper chaperone anticorps (AA 174-209) (ABIN5647094)

Antigène: Superoxide dismutase copper chaperone (CCS) (Copper Chaperone For Superoxide Dismutase (CCS))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Superoxide dismutase copper chaperone est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-Superoxide dismutase copper chaperone anticorps

Épitope: AA 174-209

Fonction: CCS Antibody

Séquence: DADGRAIFRM EDEQLKVWDV IGRSLIIDEG EDDLGR

Purification: Antigen affinity

Immunogène: Amino acids 174-209 (DADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGR) from the human protein were used as the immunogen for the CCS antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the CCS antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the CCS antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur Superoxide dismutase copper chaperone

Antigène: Superoxide dismutase copper chaperone (CCS) (Copper Chaperone For Superoxide Dismutase (CCS))

Autre désignation: CCS

Sujet: Copper chaperone for superoxide dismutase (CCS, SOD4) is a metalloprotein that is responsible for the delivery of Cu to superoxide dismutase (SOD1). In humans the protein is encoded by the CCS gene. And this gene is mapped to chromosome 11q13 by fluorescence in situ hybridization. The CCS protein is present in mammals and most eukaryotes including yeast. The structure of CCS is composed of three distinct domains that are necessary for its function. Although CCS is important for many organisms, there are CCS independent pathways for SOD1, and many species lack CCS all together, such as C. elegans.

UniProt: O14618

Pathways: Transition Metal Ion Homeostasis