alpha Defensin 1 anticorps (AA 65-94)

N° du produit ABIN5647108

L’anticorps Lapin Polyclonal anti-alpha Defensin 1 a été validé pour WB. Il convient pour détecter alpha Defensin 1 dans des échantillons de Humain et Rat.

Aperçu rapide pour alpha Defensin 1 anticorps (AA 65-94) (ABIN5647108)

Antigène: alpha Defensin 1 (DEFA1) (Defensin, alpha 1 (DEFA1))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp alpha Defensin 1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-alpha Defensin 1 anticorps

Épitope: AA 65-94

Purification: Antigen affinity purified

Immunogène: Amino acids 65-94 (ACYCRIPACIAGERRYGTCIYQGRLWAFCC) from the human protein were used as the immunogen for the Alpha Defensin 1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the Alpha Defensin 1 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the Alpha Defensin 1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur alpha Defensin 1

Antigène: alpha Defensin 1 (DEFA1) (Defensin, alpha 1 (DEFA1))

Autre désignation: Alpha Defensin 1 / DEFA1

Sujet: Defensin, alpha 1, also known as human alpha defensin 1, human neutrophil peptide 1 (HNP-1) or neutrophil defensin 1 is a human protein that is encoded by the DEFA1 gene. Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. The protein encoded by this gene, defensin, alpha 1, is found in the microbicidal granules of neutrophils and likely plays a role in phagocyte-mediated host defense. Several alpha defensin genes are clustered on chromosome 8. This gene differs from defensin, alpha 3 by only one amino acid. This gene and the gene encoding defensin, alpha 3 are both subject to copy number variation.

UniProt: P59665

Pathways: Cellular Response to Molecule of Bacterial Origin