HOXB1 anticorps (AA 176-220)

N° du produit ABIN5647148

Cet anticorps anti-HOXB1 Polyclonal Lapin (ABIN5647148) détecte spécifiquement HOXB1 dans WB. L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour HOXB1 anticorps (AA 176-220) (ABIN5647148)

Antigène: HOXB1 (Homeobox B1 (HOXB1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HOXB1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HOXB1 anticorps

Épitope: AA 176-220

Fonction: HOXB1 Antibody (C-Terminal Region)

Séquence: TARTFDWMKV KRNPPKTAKV SEPGLGSPSG LRTNFTTRQL TELEK

Purification: Antigen affinity

Immunogène: Amino acids 176-220 (TARTFDWMKVKRNPPKTAKVSEPGLGSPSGLRTNFTTRQLTELEK) were used as the immunogen for the HOXB1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the HOXB1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the HOXB1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur HOXB1

Antigène: HOXB1 (Homeobox B1 (HOXB1))

Autre désignation: HOXB1

Sujet: Homeobox protein Hox-B1 is a protein that in humans is encoded by the HOXB1 gene. This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXB genes located in a cluster on chromosome 17.

UniProt: P14653