XPO5 anticorps (AA 2-43)

N° du produit ABIN5647153

Détail du produit anti-XPO5 anticorps

Antigène: XPO5 (Exportin 5 (XPO5))

Épitope: AA 2-43

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp XPO5 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogène: Amino acids 2-43 (AMDQVNALCEQLVKAVTVMMDPNSTQRYRLEALKFCEEFKEK) were used as the immunogen for the Exportin-5 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the Exportin-5 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the Exportin-5 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur XPO5

Antigène: XPO5 (Exportin 5 (XPO5))

Autre désignation: Exportin-5 (XPO5 Produits)

Synonymes: anticorps exp5, anticorps CG12234, anticorps Dmel\\CG12234, anticorps Exp-5, anticorps Exp5, anticorps RanBP21, anticorps dmExp5, anticorps 2410004H11Rik, anticorps 2700038C24Rik, anticorps AI648907, anticorps AW549301, anticorps RanBp21, anticorps mKIAA1291, anticorps exportin-5, anticorps ranbp21, anticorps DDBDRAFT_0185980, anticorps DDBDRAFT_0237583, anticorps DDB_0185980, anticorps DDB_0237583, anticorps XPO5, anticorps exportin 5, anticorps CG12234 gene product from transcript CG12234-RB, anticorps armadillo-like helical domain-containing protein, anticorps XPO5, anticorps Ranbp21, anticorps Xpo5, anticorps xpo5

Sujet: Exportin-5 (XPO5) is a protein that in humans is encoded by the XPO5 gene. The International Radiation Hybrid Mapping Consortium mapped the XPO5 gene to chromosome 6. This gene encodes a member of the karyopherin family that is required for the transport of small RNAs and double-stranded RNA-binding proteins from the nucleus to the cytoplasm. The encoded protein translocates cargo through the nuclear pore complex in a RanGTP-dependent process.

UniProt: Q9HAV4

Pathways: Regulatory RNA Pathways, Protein targeting to Nucleus