MC3R anticorps (AA 91-121)

N° du produit ABIN5647192

Détail du produit anti-MC3R anticorps

Antigène: MC3R (Melanocortin 3 Receptor (MC3R))

Épitope: AA 91-121

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MC3R est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogène: Amino acids 91-121 (NALETIMIAIVHSDYLTFEDQFIQHMDNIFD) from the human protein were used as the immunogen for the MC3 Receptor antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the MC3 Receptor antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the MC3 Receptor antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur MC3R

Antigène: MC3R (Melanocortin 3 Receptor (MC3R))

Autre désignation: MC3R / MC3 Receptor (MC3R Produits)

Synonymes: anticorps zgc:194235, anticorps MC3-R, anticorps BMIQ9, anticorps MC3, anticorps OB20, anticorps OQTL, anticorps melanocortin 3 receptor, anticorps mc3r, anticorps MC3R, anticorps Mc3r

Sujet: Melanocortin receptor 3 is a protein that in humans is encoded by the MC3R gene. It is mapped to 20q13.2. This gene encodes a G-protein-coupled receptor for melanocyte-stimulating hormone and adrenocorticotropic hormone that is expressed in tissues other than the adrenal cortex and melanocytes. This gene maps to the same region as the locus for benign neonatal epilepsy. Mice deficient for this gene have increased fat mass despite decreased food intake, suggesting a role for this gene product in the regulation of energy homeostasis. Mutations in this gene are associated with a susceptibility to obesity in humans.

UniProt: P41968

Pathways: cAMP Metabolic Process