Myoglobin anticorps (AA 3-35)

N° du produit ABIN5647210

L’anticorps Lapin Polyclonal anti-Myoglobin a été validé pour WB. Il convient pour détecter Myoglobin dans des échantillons de Humain.

Aperçu rapide pour Myoglobin anticorps (AA 3-35) (ABIN5647210)

Antigène: Myoglobin (MB)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Myoglobin est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Myoglobin anticorps

Épitope: AA 3-35

Purification: Antigen affinity purified

Immunogène: Amino acids 3-35 (LSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFK) were used as the immunogen for the Myoglobin antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the Myoglobin antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the Myoglobin antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur Myoglobin

Antigène: Myoglobin (MB)

Autre désignation: Myoglobin

Sujet: Myoglobin (MB) also known as PVALB, is a single-chain globular protein of 153 or 154 amino acids, containing a heme (iron-containing porphyrin) prosthetic group in the center around which the remaining apoprotein folds. It is a member of the globin superfamily and is expressed in skeletal and cardiac muscles. This gene is mapped to chromosome 22q11-q13. Myoglobin is released from damaged muscle tissue (rhabdomyolysis), which has very high concentrations of myoglobin. The released myoglobin is filtered by the kidneys but is toxic to the renal tubular epithelium and so may cause acute renal failure.

UniProt: P02144

Pathways: Brown Fat Cell Differentiation