PPL anticorps (AA 1664-1701)

N° du produit ABIN5647242

Détail du produit anti-PPL anticorps

Antigène: PPL (Periplakin (PPL))

Épitope: AA 1664-1701

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PPL est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogène: Amino acids 1664-1701 (DTGRELSPEEAHRAGLIDWNMFVKLRSQECDWEEISVK) from the human protein were used as the immunogen for the Periplakin antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the Periplakin antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the Periplakin antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur PPL

Antigène: PPL (Periplakin (PPL))

Autre désignation: Periplakin (PPL Produits)

Synonymes: anticorps cb180, anticorps sb:cb180, anticorps im:7140067, anticorps im:7149519, anticorps AW553870, anticorps periplakin, anticorps periplakin L homeolog, anticorps PPL, anticorps ppl, anticorps ppl.L, anticorps Ppl

Sujet: Periplakin is a protein that in humans is encoded by the PPL gene. The protein encoded by this gene is a component of desmosomes and of the epidermal cornified envelope in keratinocytes. The N-terminal domain of this protein interacts with the plasma membrane and its C-terminus interacts with intermediate filaments. Through its rod domain, this protein forms complexes with envoplakin. This protein may serve as a link between the cornified envelope and desmosomes as well as intermediate filaments. AKT1/PKB, a protein kinase mediating a variety of cell growth and survival signaling processes, is reported to interact with this protein, suggesting a possible role for this protein as a localization signal in AKT1-mediated signaling.

UniProt: O60437