Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

RPS6 anticorps (AA 13-52)

Cet anticorps anti-RPS6 est un anticorps Polyclonal produit chez le Lapin, détectant RPS6 dans WB et IHC (p). Convient pour Humain, Souris et Rat.
N° du produit ABIN5647262
644,88 €
Plus frais de livraison 40,00 € et TVA
100 μg
Destination: France
Envoi sous 6 à 8 jours ouvrables

Aperçu rapide pour RPS6 anticorps (AA 13-52) (ABIN5647262)

Antigène

Voir toutes RPS6 Anticorps
RPS6 (Ribosomal Protein S6 (RPS6))

Reactivité

  • 142
  • 131
  • 118
  • 12
  • 12
  • 10
  • 10
  • 10
  • 8
  • 8
  • 7
  • 7
  • 5
  • 5
  • 5
  • 4
  • 2
  • 2
  • 2
  • 1
Humain, Souris, Rat

Hôte

  • 161
  • 10
  • 2
  • 2
Lapin

Clonalité

  • 143
  • 32
Polyclonal

Conjugué

  • 81
  • 11
  • 8
  • 6
  • 5
  • 5
  • 4
  • 4
  • 4
  • 4
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 2
  • 2
Cet anticorp RPS6 est non-conjugé

Application

  • 151
  • 58
  • 56
  • 43
  • 40
  • 40
  • 27
  • 27
  • 20
  • 17
  • 11
  • 3
  • 3
  • 2
  • 1
  • 1
  • 1
Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
  • Épitope

    • 47
    • 29
    • 27
    • 25
    • 15
    • 14
    • 13
    • 9
    • 9
    • 5
    • 5
    • 5
    • 4
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 13-52

    Purification

    Antigen affinity purified

    Immunogène

    Amino acids 13-52 (QKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRI) from the human protein were used as the immunogen for the RPS6 antibody.

    Isotype

    IgG
  • Indications d'application

    Optimal dilution of the RPS6 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

    Restrictions

    For Research Use only
  • Buffer

    0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

    Stock

    -20 °C

    Stockage commentaire

    After reconstitution, the RPS6 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Antigène

    RPS6 (Ribosomal Protein S6 (RPS6))

    Autre désignation

    RPS6

    Sujet

    Ribosomal protein S6 (rpS6) is a component of the 40S ribosomal subunit and is therefore thought to be involved in regulating translation. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a cytoplasmic ribosomal protein that is a component of the 40S subunit. The protein belongs to the S6E family of ribosomal proteins. It is the major substrate of protein kinases in the ribosome, with subsets of five C-terminal serine residues phosphorylated by different protein kinases. Phosphorylation is induced by a wide range of stimuli, including growth factors, tumor-promoting agents, and mitogens. Dephosphorylation occurs at growth arrest. The protein may contribute to the control of cell growth and proliferation through the selective translation of particular classes of mRNA. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. While the true function of rpS6 is currently under investigation, studies have shown that it is involved in the regulation of cell size, cell proliferation, and glucose homeostasis.

    UniProt

    P62753

    Pathways

    Carbohydrate Homeostasis, Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly
Vous êtes ici:
Chat with us!