Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

RPS6 anticorps (AA 13-52)

RPS6 Reactivité: Humain, Souris, Rat WB, IHC (p) Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN5647262
  • Antigène Voir toutes RPS6 Anticorps
    RPS6 (Ribosomal Protein S6 (RPS6))
    Épitope
    • 45
    • 25
    • 22
    • 21
    • 15
    • 15
    • 13
    • 12
    • 9
    • 9
    • 7
    • 5
    • 5
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 13-52
    Reactivité
    • 145
    • 125
    • 112
    • 12
    • 12
    • 10
    • 10
    • 9
    • 8
    • 8
    • 7
    • 7
    • 5
    • 5
    • 5
    • 4
    • 2
    • 2
    • 2
    • 1
    Humain, Souris, Rat
    Hôte
    • 163
    • 10
    • 2
    • 2
    Lapin
    Clonalité
    • 164
    • 13
    Polyclonal
    Conjugué
    • 88
    • 11
    • 9
    • 7
    • 5
    • 4
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    Cet anticorp RPS6 est non-conjugé
    Application
    • 143
    • 67
    • 45
    • 40
    • 40
    • 34
    • 28
    • 18
    • 10
    • 10
    • 9
    • 3
    • 3
    • 2
    • 1
    • 1
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Purification
    Antigen affinity purified
    Immunogène
    Amino acids 13-52 (QKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRI) from the human protein were used as the immunogen for the RPS6 antibody.
    Isotype
    IgG
    Top Product
    Discover our top product RPS6 Anticorps primaire
  • Indications d'application
    Optimal dilution of the RPS6 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL
    Restrictions
    For Research Use only
  • Buffer
    0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
    Stock
    -20 °C
    Stockage commentaire
    After reconstitution, the RPS6 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Antigène
    RPS6 (Ribosomal Protein S6 (RPS6))
    Autre désignation
    RPS6 (RPS6 Produits)
    Synonymes
    anticorps S6, anticorps rps6, anticorps rps6a, anticorps S6R, anticorps (Rp)S6, anticorps CG10944, anticorps DS6, anticorps Dmel\\CG10944, anticorps M(1)7BC, anticorps M(1)7C, anticorps RPS6, anticorps Rp S6, anticorps Rps6, anticorps air8, anticorps air[8], anticorps anon-WO02059370.61, anticorps hen, anticorps l(1)air8, anticorps l(1)air[8], anticorps l(1)hen, anticorps pp30, anticorps rpS6, anticorps wu:fa92e06, anticorps wu:fb64g06, anticorps zgc:92237, anticorps ribosomal protein S6, anticorps ribosomal protein S6 S homeolog, anticorps S6 ribosomal protein, anticorps Ribosomal protein S6, anticorps 30S ribosomal protein S6, anticorps 40S ribosomal protein S6, anticorps RPS6, anticorps rps6.S, anticorps LOC100135859, anticorps Rps6, anticorps RpS6, anticorps rps6, anticorps rps-6, anticorps LOC100533219
    Sujet
    Ribosomal protein S6 (rpS6) is a component of the 40S ribosomal subunit and is therefore thought to be involved in regulating translation. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a cytoplasmic ribosomal protein that is a component of the 40S subunit. The protein belongs to the S6E family of ribosomal proteins. It is the major substrate of protein kinases in the ribosome, with subsets of five C-terminal serine residues phosphorylated by different protein kinases. Phosphorylation is induced by a wide range of stimuli, including growth factors, tumor-promoting agents, and mitogens. Dephosphorylation occurs at growth arrest. The protein may contribute to the control of cell growth and proliferation through the selective translation of particular classes of mRNA. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. While the true function of rpS6 is currently under investigation, studies have shown that it is involved in the regulation of cell size, cell proliferation, and glucose homeostasis.
    UniProt
    P62753
    Pathways
    Carbohydrate Homeostasis, Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly
Vous êtes ici:
Support technique