SAFB anticorps (AA 715-754)

N° du produit ABIN5647265

Cet anticorps anti-SAFB est un anticorps Lapin Polyclonal détectant SAFB dans WB. Adapté pour Humain.

Aperçu rapide pour SAFB anticorps (AA 715-754) (ABIN5647265)

Antigène: SAFB (Scaffold Attachment Factor B (SAFB))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SAFB est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SAFB anticorps

Épitope: AA 715-754

Purification: Antigen affinity purified

Immunogène: Amino acids 715-754 (DLDRRDDAYWPEAKRAALDERYHSDFNRQDRFHDFDHRDR) from the human protein were used as the immunogen for the SAFB antibody.

Isotype: IgG

Information d'application

Indications d'application: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the SAFB antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur SAFB

Antigène: SAFB (Scaffold Attachment Factor B (SAFB))

Autre désignation: SAFB / Scaffold attachment factor B1

Sujet: Scaffold attachment factor B, also known as SAFB, is a gene with homologs that have been studied in humans and mice. This gene encodes a DNA-binding protein which has high specificity for scaffold or matrix attachment region DNA elements (S/MAR DNA). This protein is thought to be involved in attaching the base of chromatin loops to the nuclear matrix but there is conflicting evidence as to whether this protein is a component of chromatin or a nuclear matrix protein. Scaffold attachment factors are a specific subset of nuclear matrix proteins (NMP) that specifically bind to S/MAR. The encoded protein is thought to serve as a molecular base to assemble a 'transcriptosome complex' in the vicinity of actively transcribed genes. It is involved in the regulation of heat shock protein 27 transcription, can act as an estrogen receptor co-repressor and is a candidate for breast tumorigenesis. This gene is arranged head-to-head with a similar gene whose product has the same functions. Multiple transcript variants encoding different isoforms have been found for this gene.

UniProt: Q15424

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway