SAFB anticorps (AA 715-754)

N° du produit ABIN5647265

Détail du produit anti-SAFB anticorps

Antigène: SAFB (Scaffold Attachment Factor B (SAFB))

Épitope: AA 715-754

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SAFB est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogène: Amino acids 715-754 (DLDRRDDAYWPEAKRAALDERYHSDFNRQDRFHDFDHRDR) from the human protein were used as the immunogen for the SAFB antibody.

Isotype: IgG

Information d'application

Indications d'application: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the SAFB antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur SAFB

Antigène: SAFB (Scaffold Attachment Factor B (SAFB))

Autre désignation: SAFB / Scaffold attachment factor B1 (SAFB Produits)

Synonymes: anticorps HAP, anticorps HET, anticorps SAF-B1, anticorps SAFB1, anticorps 3110021E02Rik, anticorps 5330423C17Rik, anticorps AU018122, anticorps D18386, anticorps E130307D12, anticorps zgc:55387, anticorps wu:fb40a03, anticorps wu:fd42g06, anticorps SAFB2, anticorps SAFB, anticorps scaffold attachment factor B, anticorps scaffold attachment factor B S homeolog, anticorps SAFB-like transcription modulator, anticorps Scaffold attachment factor B, anticorps SAFB, anticorps Safb, anticorps safb, anticorps safb.S, anticorps LOC5570070, anticorps CpipJ_CPIJ017179, anticorps Bm1_49330, anticorps LOAG_00080

Sujet: Scaffold attachment factor B, also known as SAFB, is a gene with homologs that have been studied in humans and mice. This gene encodes a DNA-binding protein which has high specificity for scaffold or matrix attachment region DNA elements (S/MAR DNA). This protein is thought to be involved in attaching the base of chromatin loops to the nuclear matrix but there is conflicting evidence as to whether this protein is a component of chromatin or a nuclear matrix protein. Scaffold attachment factors are a specific subset of nuclear matrix proteins (NMP) that specifically bind to S/MAR. The encoded protein is thought to serve as a molecular base to assemble a 'transcriptosome complex' in the vicinity of actively transcribed genes. It is involved in the regulation of heat shock protein 27 transcription, can act as an estrogen receptor co-repressor and is a candidate for breast tumorigenesis. This gene is arranged head-to-head with a similar gene whose product has the same functions. Multiple transcript variants encoding different isoforms have been found for this gene.

UniProt: Q15424

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway