SCTR anticorps (AA 398-440)

N° du produit ABIN5647267

L’anticorps Lapin Polyclonal anti-SCTR a été validé pour WB. Il convient pour détecter SCTR dans des échantillons de Humain et Rat.

Aperçu rapide pour SCTR anticorps (AA 398-440) (ABIN5647267)

Antigène: SCTR (Secretin Receptor (SCTR))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SCTR est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SCTR anticorps

Épitope: AA 398-440

Purification: Antigen affinity purified

Immunogène: Amino acids 398-440 (EVQKKWQQWHLREFPLHPVASFSNSTKASHLEQSQGTCRTSII) from the human protein were used as the immunogen for the SCTR antibody.

Isotype: IgG

Information d'application

Indications d'application: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the SCTR antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur SCTR

Antigène: SCTR (Secretin Receptor (SCTR))

Autre désignation: SCTR

Sujet: Human secretin receptor (gene name SCTR) is a G protein-coupled receptor and belongs to the glucagon-VIP-secretin receptor family. It binds secretin which is the most potent regulator of pancreatic bicarbonate, electrolyte and volume secretion. Secretin and its receptor are suggested to be involved in pancreatic cancer and autism. The SCTR gene is mapped to chromosome 2q14.1 by fluorescence in situ hybridization.

UniProt: P47872