TFPI2 anticorps (AA 70-105)

N° du produit ABIN5647314

Cet anticorps Lapin Polyclonal détecte spécifiquement TFPI2 dans WB et IHC (p). Il présente une réactivité envers Humain et Souris.

Aperçu rapide pour TFPI2 anticorps (AA 70-105) (ABIN5647314)

Antigène: TFPI2 (Tissue Factor Pathway Inhibitor 2 (TFPI2))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TFPI2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-TFPI2 anticorps

Épitope: AA 70-105

Purification: Antigen affinity purified

Immunogène: Amino acids 70-105 (EGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQ) from the human protein were used as the immunogen for the TFPI2 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the TFPI2 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the TFPI2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur TFPI2

Antigène: TFPI2 (Tissue Factor Pathway Inhibitor 2 (TFPI2))

Autre désignation: TFPI2

Sujet: Tissue factor pathway inhibitor 2, also known as TFPI2, is a human gene which is located at 7q22. It is an important regulator of the extrinsic pathway of blood coagulation through its ability to inhibit factor Xa and factor VIIa-tissue factor activity. After a 22-residue signal peptide, the mature TFPI2 protein contains 213 amino acids with 18 cysteines and 2 canonical N-linked glycosylation sites. The purified recombinant TFPI2 strongly inhibited the amidolytic activities of trypsin and the factor VIIa-tissue factor complex. The latter inhibition was markedly enhanced in the presence of heparin. Mouse TFPI2 mRNA is highly expressed in developing mouse placenta, as in human. And there are also high transcript levels in adult mouse liver and kidney.

UniProt: P48307