Endoglin anticorps (AA 258-297)

N° du produit ABIN5647366

L’anticorps Lapin Polyclonal anti-Endoglin a été validé pour WB. Il convient pour détecter Endoglin dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour Endoglin anticorps (AA 258-297) (ABIN5647366)

Antigène: Endoglin (ENG)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Endoglin est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Endoglin anticorps

Épitope: AA 258-297

Purification: Antigen affinity purified

Immunogène: Amino acids 258-297 (YVSWLIDANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQ) from the human protein were used as the immunogen for the Endoglin antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the Endoglin antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the Endoglin antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur Endoglin

Antigène: Endoglin (ENG)

Autre désignation: CD105 / Endoglin

Sujet: Endoglin (Osler-Rendu-Weber syndrome 1), also called CD105, is a type I membrane glycoprotein located on cell surfaces and is a part of the TGF beta receptor complex. Its gene is mapped to human chromosome 8. The protein consists of a homodimer of 180 kDA with disulfide links. It has been found on endothelial cells, activated macrophages, fibroblasts and smooth muscle cells. Endoglin has a role in the development of the cardiovascular system and in vascular remodeling and has been found to be elevated in pregnant women who subsequently develop preeclampsia.

UniProt: P17813