AKAP2 anticorps (AA 813-852)

N° du produit ABIN5647409

Cet anticorps anti-AKAP2 est un anticorps Lapin Polyclonal détectant AKAP2 dans WB. Adapté pour Humain et Rat.

Aperçu rapide pour AKAP2 anticorps (AA 813-852) (ABIN5647409)

Antigène: AKAP2 (A Kinase (PRKA) Anchor Protein 2 (AKAP2))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AKAP2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-AKAP2 anticorps

Épitope: AA 813-852

Purification: Antigen affinity purified

Immunogène: Amino acids 813-852 (ETHKSKRRERMDDSSVLEATRVNRRKSALALRWEAGIYAN) from the human protein were used as the immunogen for the AKAP2 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the AKAP2 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the AKAP2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur AKAP2

Antigène: AKAP2 (A Kinase (PRKA) Anchor Protein 2 (AKAP2))

Autre désignation: AKAP2

Sujet: A-kinase anchor protein 2 is an enzyme that in humans is encoded by the AKAP2 gene. It is mapped to 9q31.3. The protein encoded by this gene binds to the regulatory subunit of protein kinase A and is found associated with the actin cytoskeleton. The encoded protein mediates signals carried by cAMP and may be involved in creating polarity in certain signaling processes. Three transcript variants encoding different isoforms have been found for this gene.

UniProt: Q9Y2D5