AKAP2 anticorps (AA 813-852)

N° du produit ABIN5647409

Détail du produit anti-AKAP2 anticorps

Antigène: AKAP2 (A Kinase (PRKA) Anchor Protein 2 (AKAP2))

Épitope: AA 813-852

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AKAP2 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogène: Amino acids 813-852 (ETHKSKRRERMDDSSVLEATRVNRRKSALALRWEAGIYAN) from the human protein were used as the immunogen for the AKAP2 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the AKAP2 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the AKAP2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur AKAP2

Antigène: AKAP2 (A Kinase (PRKA) Anchor Protein 2 (AKAP2))

Autre désignation: AKAP2 (AKAP2 Produits)

Synonymes: anticorps AKAP-2, anticorps AKAPKL, anticorps PRKA2, anticorps AA959716, anticorps AI649048, anticorps Akap-2, anticorps Akap-kl, anticorps B230340M18Rik, anticorps Prka2, anticorps akap-kl, anticorps AKAP2, anticorps PALM2, anticorps A-kinase anchoring protein 2, anticorps A kinase (PRKA) anchor protein 2, anticorps A-kinase anchoring protein 2 L homeolog, anticorps A-kinase anchor protein 2, anticorps AKAP2, anticorps Akap2, anticorps akap2.L, anticorps akap2, anticorps LOC101114239

Sujet: A-kinase anchor protein 2 is an enzyme that in humans is encoded by the AKAP2 gene. It is mapped to 9q31.3. The protein encoded by this gene binds to the regulatory subunit of protein kinase A and is found associated with the actin cytoskeleton. The encoded protein mediates signals carried by cAMP and may be involved in creating polarity in certain signaling processes. Three transcript variants encoding different isoforms have been found for this gene.

UniProt: Q9Y2D5