CRX anticorps (AA 265-299)

N° du produit ABIN5647525

Détail du produit anti-CRX anticorps

Antigène: CRX (Cone-Rod Homeobox (CRX))

Épitope: AA 265-299

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CRX est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogène: Amino acids 265-299 (DSLEFKDPTGTWKFTYNPMDPLDYKDQSAWKFQIL) from the human protein were used as the immunogen for the CRX antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the CRX antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the CRX antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur CRX

Antigène: CRX (Cone-Rod Homeobox (CRX))

Autre désignation: CRX (Cone-rod homeobox) (CRX Produits)

Synonymes: anticorps Xotx5, anticorps Xotx5b, anticorps cord2, anticorps crd, anticorps otx5, anticorps otx5b, anticorps rx, anticorps CRX, anticorps crx, anticorps otx5-b, anticorps CORD2, anticorps CRD, anticorps LCA7, anticorps OTX3, anticorps Crx1, anticorps otx5-A, anticorps cone-rod homeobox, anticorps cone-rod homeobox L homeolog, anticorps cone-rod homeobox S homeolog, anticorps crx, anticorps CRX, anticorps Crx, anticorps crx.L, anticorps crx.S

Sujet: Cone-rod homeobox protein is a protein that in humans is encoded by the CRX gene. The protein encoded by this gene is a photoreceptor-specific transcription factor which plays a role in the differentiation of photoreceptor cells. This homeodomain protein is necessary for the maintenance of normal cone and rod function. Mutations in this gene are associated with photoreceptor degeneration, Leber congenital amaurosis type III and the autosomal dominant cone-rod dystrophy 2. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some variants has not been determined.

UniProt: O43186